SCOPe 2.06: Domain d1p6ta1: 1p6t A:1-72

Lineage for d1p6ta1 (1p6t A:1-72)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Potential copper-translocating P-type ATPase CopA (YvgX) [75441] (1 species)
   duplication: contains tandem repeat of two HMA domains in the N-terminal region

7. Species Bacillus subtilis [TaxId:1423] [75442] (6 PDB entries)

8. Domain d1p6ta1: 1p6t A:1-72 [94188]
   Other proteins in same PDB: d1p6ta3

Details for d1p6ta1

PDB Entry: 1p6t

PDB Description: structure characterization of the water soluble region of p-type atpase copa from bacillus subtilis

PDB Compounds: (A:) Potential copper-transporting ATPase

SCOPe Domain Sequences for d1p6ta1:

Sequence; same for both SEQRES and ATOM records:

>d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}
mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
qekieklgyhvv

Timeline for d1p6ta1:

• d1p6ta1 first appeared in SCOP 1.67
  
• d1p6ta1 appears in SCOPe 2.05
  
• d1p6ta1 appears in SCOPe 2.07
  
• d1p6ta1 appears in the current release, SCOPe 2.08