Lineage for d1p6ra_ (1p6r A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983732Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
    automatically mapped to Pfam PF03965
  6. 1983751Protein Penicillinase repressor BlaI [101019] (2 species)
  7. 1983752Species Bacillus licheniformis [TaxId:1402] [101020] (2 PDB entries)
  8. 1983753Domain d1p6ra_: 1p6r A: [94187]
    DNA-binding domain only

Details for d1p6ra_

PDB Entry: 1p6r (more details)

PDB Description: solution structure of the dna binding domain of the repressor blai.
PDB Compounds: (A:) Penicillinase repressor

SCOPe Domain Sequences for d1p6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6ra_ a.4.5.39 (A:) Penicillinase repressor BlaI {Bacillus licheniformis [TaxId: 1402]}
mkkipqisdaelevmkviwkhssintnevikelsktstwspktiqtmllrlikkgalnhh
kegrvfvytpnidesdyievks

SCOPe Domain Coordinates for d1p6ra_:

Click to download the PDB-style file with coordinates for d1p6ra_.
(The format of our PDB-style files is described here.)

Timeline for d1p6ra_: