Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families) |
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (1 protein) |
Protein Cytosine deaminase [89801] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (4 PDB entries) |
Domain d1p6oa_: 1p6o A: [94185] |
PDB Entry: 1p6o (more details), 1.14 Å
SCOP Domain Sequences for d1p6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p6oa_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae)} tggmaskwdqkgmdiayeeaalgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlh geistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekyl qtrghevvvvdderckkimkqfiderpqdwfedige
Timeline for d1p6oa_: