Lineage for d1p6fa1 (1p6f A:4-98)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 454655Family b.1.1.4: I set domains [49159] (32 proteins)
  6. 454871Protein Ligand binding domain of NK receptor NKp46 [101519] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 454872Species Human (Homo sapiens) [TaxId:9606] [101520] (2 PDB entries)
  8. 454875Domain d1p6fa1: 1p6f A:4-98 [94169]

Details for d1p6fa1

PDB Entry: 1p6f (more details), 2.2 Å

PDB Description: Structure of the human natural cytotoxicity receptor NKp46

SCOP Domain Sequences for d1p6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6fa1 b.1.1.4 (A:4-98) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens)}
tlpkpfiwaephfmvpkekqvticcqgnygaveyqlhfegslfavdrpkpperinkvkfy
ipdmnsrmagqysciyrvgelwsepsnlldlvvte

SCOP Domain Coordinates for d1p6fa1:

Click to download the PDB-style file with coordinates for d1p6fa1.
(The format of our PDB-style files is described here.)

Timeline for d1p6fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p6fa2