SCOPe 2.05: Domain d1p6ea_: 1p6e A:

Lineage for d1p6ea_ (1p6e A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.124: Phospholipase C/P1 nuclease [48536] (1 superfamily)
   multihelical

4. Superfamily a.124.1: Phospholipase C/P1 nuclease [48537] (3 families)
   duplication: all chain but the N-terminal helix forms two structural repeats

5. Family a.124.1.1: Phospholipase C [48538] (3 proteins)

6. Protein Bacterial phosholipase C [48539] (1 species)

7. Species Bacillus cereus [TaxId:1396] [48540] (7 PDB entries)

8. Domain d1p6ea_: 1p6e A: [94168]
   complexed with pc5, zn; mutant

Details for d1p6ea_

PDB Entry: 1p6e, 2.3 Å

PDB Description: structure of the d55n mutant of phospholipase c from bacillus cereus in complex with 1,2-di-n-pentanoyl-sn-glycero-3-dithiophosphocholine

PDB Compounds: (A:) phospholipase c

SCOPe Domain Sequences for d1p6ea_:

Sequence; same for both SEQRES and ATOM records:

>d1p6ea_ a.124.1.1 (A:) Bacterial phosholipase C {Bacillus cereus [TaxId: 1396]}
wsaedkhkegvnshlwivnraidimsrnttlvkqdrvaqlnewrtelengiyaanyenpy
ydnstfashfydpdngktyipfakqaketgakyfklagesyknkdmkqaffylglslhyl
gdvnqpmhaanftnlsypqgfhskyenfvdtikdnykvtdgngywnwkgtnpeewihgaa
vvakqdysgivndntkdwfvkaavsqeyadkwraevtpmtgkrlmdaqrvtagyiqlwfd
tygdr

Timeline for d1p6ea_:

• d1p6ea_ first appeared in SCOP 1.67
  
• d1p6ea_ appears in SCOPe 2.04
  
• d1p6ea_ appears in SCOPe 2.06
  
• d1p6ea_ appears in the current release, SCOPe 2.08