SCOPe 2.04: Domain d1p6cb_: 1p6c B:

Lineage for d1p6cb_ (1p6c B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (4 species)

7. Species Flavobacterium sp. atcc 27551 [TaxId:74567] [102087] (2 PDB entries)
   identical sequence to the Pseudomonas diminuta PTE

8. Domain d1p6cb_: 1p6c B: [94166]
   complexed with dii, ebp, zn; mutant

Details for d1p6cb_

PDB Entry: 1p6c, 2 Å

PDB Description: crystal structure of phosphotriesterase triple mutant h254g/h257w/l303t complexed with diisopropylmethylphosphonate

PDB Compounds: (B:) Parathion hydrolase

SCOPe Domain Sequences for d1p6cb_:

Sequence; same for both SEQRES and ATOM records:

>d1p6cb_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Flavobacterium sp. atcc 27551 [TaxId: 74567]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallgi
rswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflsptlra

Timeline for d1p6cb_:

• d1p6cb_ first appeared in SCOP 1.67
  
• d1p6cb_ appears in SCOPe 2.03
  
• d1p6cb_ appears in SCOPe 2.05
  
• d1p6cb_ appears in the current release, SCOPe 2.08