Lineage for d1p6bb_ (1p6b B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683699Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins)
  6. 683700Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species)
  7. 683705Species Flavobacterium sp. atcc 27551 [TaxId:74567] [102087] (2 PDB entries)
    identical sequence to the Pseudomonas diminuta PTE
  8. 683707Domain d1p6bb_: 1p6b B: [94164]
    complexed with ebp, efs, lcx, zn; mutant

Details for d1p6bb_

PDB Entry: 1p6b (more details), 1.9 Å

PDB Description: x-ray structure of phosphotriesterase, triple mutant h254g/h257w/l303t
PDB Compounds: (B:) Parathion hydrolase

SCOP Domain Sequences for d1p6bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6bb_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Flavobacterium sp. atcc 27551 [TaxId: 74567]}
gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqa
aifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallg
irswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvi
pflrekgvpqetlagitvtnparflsptlra

SCOP Domain Coordinates for d1p6bb_:

Click to download the PDB-style file with coordinates for d1p6bb_.
(The format of our PDB-style files is described here.)

Timeline for d1p6bb_: