SCOPe 2.07: Domain d1p6ab1: 1p6a B:24-146

Lineage for d1p6ab1 (1p6a B:24-146)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)

8. Domain d1p6ab1: 1p6a B:24-146 [94162]
   Other proteins in same PDB: d1p6aa_, d1p6ab2
   mutant

Details for d1p6ab1

PDB Entry: 1p6a, 2.9 Å

PDB Description: structural basis for variation in adenovirus affinity for the cellular receptor car (s489y mutant)

PDB Compounds: (B:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d1p6ab1:

Sequence; same for both SEQRES and ATOM records:

>d1p6ab1 b.1.1.1 (B:24-146) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
ittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiyd
dyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvkp
sga

Timeline for d1p6ab1:

• d1p6ab1 first appeared in SCOP 1.67, called d1p6ab_
  
• d1p6ab1 appears in SCOPe 2.06
  
• d1p6ab1 appears in the current release, SCOPe 2.08