SCOP 1.69: Domain d1p6ab_: 1p6a B:

Lineage for d1p6ab_ (1p6a B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48731] (6 PDB entries)

8. Domain d1p6ab_: 1p6a B: [94162]
   Other proteins in same PDB: d1p6aa_

Details for d1p6ab_

PDB Entry: 1p6a, 2.9 Å

PDB Description: structural basis for variation in adenovirus affinity for the cellular receptor car (s489y mutant)

SCOP Domain Sequences for d1p6ab_:

Sequence; same for both SEQRES and ATOM records:

>d1p6ab_ b.1.1.1 (B:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens)}
gittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk
psga

Timeline for d1p6ab_:

• d1p6ab_ first appeared in SCOP 1.67
  
• d1p6ab_ appears in SCOP 1.71
  
• d1p6ab_ appears in the current release, SCOPe 2.08, called d1p6ab1