![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
![]() | Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48731] (6 PDB entries) |
![]() | Domain d1p6ab_: 1p6a B: [94162] Other proteins in same PDB: d1p6aa_ mutant |
PDB Entry: 1p6a (more details), 2.9 Å
SCOP Domain Sequences for d1p6ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p6ab_ b.1.1.1 (B:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens)} gittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk psga
Timeline for d1p6ab_: