Lineage for d1p6aa_ (1p6a A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386502Protein Adenovirus fiber protein "knob" domain [49837] (18 species)
  7. 2386604Species Human adenovirus type 12 [TaxId:28282] [49840] (4 PDB entries)
  8. 2386613Domain d1p6aa_: 1p6a A: [94161]
    Other proteins in same PDB: d1p6ab1, d1p6ab2
    mutant

Details for d1p6aa_

PDB Entry: 1p6a (more details), 2.9 Å

PDB Description: structural basis for variation in adenovirus affinity for the cellular receptor car (s489y mutant)
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d1p6aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6aa_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus type 12 [TaxId: 28282]}
tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaywgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe

SCOPe Domain Coordinates for d1p6aa_:

Click to download the PDB-style file with coordinates for d1p6aa_.
(The format of our PDB-style files is described here.)

Timeline for d1p6aa_: