Lineage for d1p69b1 (1p69 B:24-146)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352643Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 2352644Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)
  8. 2352650Domain d1p69b1: 1p69 B:24-146 [94160]
    Other proteins in same PDB: d1p69a_, d1p69b2
    mutant

Details for d1p69b1

PDB Entry: 1p69 (more details), 3.1 Å

PDB Description: structural basis for variation in adenovirus affinity for the cellular receptor car (p417s mutant)
PDB Compounds: (B:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d1p69b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p69b1 b.1.1.1 (B:24-146) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
ittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiyd
dyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvkp
sga

SCOPe Domain Coordinates for d1p69b1:

Click to download the PDB-style file with coordinates for d1p69b1.
(The format of our PDB-style files is described here.)

Timeline for d1p69b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p69b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p69a_