Lineage for d1p69b_ (1p69 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362734Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 362735Species Human (Homo sapiens) [TaxId:9606] [48731] (6 PDB entries)
  8. 362742Domain d1p69b_: 1p69 B: [94160]
    Other proteins in same PDB: d1p69a_
    mutant

Details for d1p69b_

PDB Entry: 1p69 (more details), 3.1 Å

PDB Description: structural basis for variation in adenovirus affinity for the cellular receptor car (p417s mutant)

SCOP Domain Sequences for d1p69b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p69b_ b.1.1.1 (B:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens)}
gittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk
psga

SCOP Domain Coordinates for d1p69b_:

Click to download the PDB-style file with coordinates for d1p69b_.
(The format of our PDB-style files is described here.)

Timeline for d1p69b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p69a_