Lineage for d1p69a_ (1p69 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048516Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2048517Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2048518Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2048519Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2048585Species Human adenovirus type 12 [TaxId:28282] [49840] (4 PDB entries)
  8. 2048594Domain d1p69a_: 1p69 A: [94159]
    Other proteins in same PDB: d1p69b1, d1p69b2
    mutant

Details for d1p69a_

PDB Entry: 1p69 (more details), 3.1 Å

PDB Description: structural basis for variation in adenovirus affinity for the cellular receptor car (p417s mutant)
PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d1p69a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p69a_ b.21.1.1 (A:) Adenovirus fiber protein "knob" domain {Human adenovirus type 12 [TaxId: 28282]}
tpydpltlwttpdpspncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe

SCOPe Domain Coordinates for d1p69a_:

Click to download the PDB-style file with coordinates for d1p69a_.
(The format of our PDB-style files is described here.)

Timeline for d1p69a_: