Lineage for d1p68a_ (1p68 A:)

  1. Root: SCOPe 2.07
  2. 2652352Class k: Designed proteins [58788] (44 folds)
  3. 2652488Fold k.8: Designed four-helix bundle protein [58832] (1 superfamily)
  4. 2652489Superfamily k.8.1: Designed four-helix bundle protein [58833] (1 family) (S)
  5. 2652490Family k.8.1.1: Designed four-helix bundle protein [58834] (4 proteins)
    this is not a true family
  6. 2652537Protein De novo designed protein s-824 [103787] (2 species)
    single-chain four-helical protein
  7. 2652538Species Synthetic [103788] (1 PDB entry)
  8. 2652539Domain d1p68a_: 1p68 A: [94158]

Details for d1p68a_

PDB Entry: 1p68 (more details)

PDB Description: solution structure of s-824, a de novo designed four helix bundle
PDB Compounds: (A:) De novo designed protein S-824

SCOPe Domain Sequences for d1p68a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p68a_ k.8.1.1 (A:) De novo designed protein s-824 {Synthetic}
mygklndlledlqevlknlhknwhggkdnlhdvdnhlqnviedihdfmqgggsggklqem
mkefqqvldelnnhlqggkhtvhhieqnikeifhhleelvhr

SCOPe Domain Coordinates for d1p68a_:

Click to download the PDB-style file with coordinates for d1p68a_.
(The format of our PDB-style files is described here.)

Timeline for d1p68a_: