Lineage for d1p63a_ (1p63 A:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.42: beta-Trefoil [50352] (8 superfamilies)
barrel, closed; n=6, S=12; and a hairpin triplet; meander
duplication: has internal pseudo threefold symmetry
Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins) 
Protein Acidic FGF (FGF1) [50357] (3 species) Species Human (Homo sapiens) [TaxId:9606] [50359] (26 PDB entries) 
Domain d1p63a_: 1p63 A: [94153]
Details for d1p63a_
PDB Entry: 1p63 (more details), 1.6 Å
PDB Description: human acidic fibroblast growth factor. 140 amino acid form with amino terminal his tag and leu111 replaced with ile (l111i)
SCOP Domain Sequences for d1p63a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p63a_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens)}
hhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyik
stetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvgikkngsc
krgprthygqkailflplpv
SCOP Domain Coordinates for d1p63a_:
Click to download the PDB-style file with coordinates for d1p63a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p63a_:
- d1p63a_ first appeared in SCOP 1.67
- d1p63a_ appears in SCOP 1.71
- d1p63a_ appears in the current release, SCOPe 2.08
View in 3D
