Lineage for d1p5wa_ (1p5w A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076286Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species)
  7. 2076287Species Canine parvovirus [TaxId:10788] [49662] (7 PDB entries)
  8. 2076290Domain d1p5wa_: 1p5w A: [94150]
    protein/DNA complex; complexed with mg; mutant

Details for d1p5wa_

PDB Entry: 1p5w (more details), 3.3 Å

PDB Description: The structures of host range controlling regions of the capsids of canine and feline parvoviruses and mutants
PDB Compounds: (A:) coat protein vp2

SCOPe Domain Sequences for d1p5wa_:

Sequence, based on SEQRES records: (download)

>d1p5wa_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Canine parvovirus [TaxId: 10788]}
gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenyrrvvvnnmdktavrgnm
alddihaqivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
tlipshtgtsgtptniyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
htwqtnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntnyiteatimrpaev
gysapyysfeastqgpfktpiaagrggaqtdenqaadgnpryafgrqhgqkttttgetpe
rftyiahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygplta
lnnvppvypngqiwdkefdtdlkprlhvnapfvcqnncpgqlfvkvapnltneydpdasa
nmsrivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpsniggmkivyeks
qlaprkly

Sequence, based on observed residues (ATOM records): (download)

>d1p5wa_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Canine parvovirus [TaxId: 10788]}
gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenyrrvvvnnmdktavrgnm
alddihaqivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvsep
ptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdrtlip
shtgtsgtptniyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlthtwq
tnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntnyiteatimrpaevgysa
pyysfeastqgpfktpiaagrggaqtdenqaadgnpryafgrqhgqkttttgetperfty
iahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygpltalnnv
ppvypngqiwdkefdtdlkprlhvnapfvcqnncpgqlfvkvapnltneydpdasanmsr
ivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpsniggmkivyeksqlap
rkly

SCOPe Domain Coordinates for d1p5wa_:

Click to download the PDB-style file with coordinates for d1p5wa_.
(The format of our PDB-style files is described here.)

Timeline for d1p5wa_: