Lineage for d1p5tb_ (1p5t B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957214Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 957215Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 957472Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 957491Protein Docking protein 1, Dok1 [101834] (1 species)
  7. 957492Species Mouse (Mus musculus) [TaxId:10090] [101835] (2 PDB entries)
    Uniprot P97465 152-254
  8. 957494Domain d1p5tb_: 1p5t B: [94149]

Details for d1p5tb_

PDB Entry: 1p5t (more details), 2.35 Å

PDB Description: Crystal Structure of Dok1 PTB Domain
PDB Compounds: (B:) Docking protein 1

SCOPe Domain Sequences for d1p5tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5tb_ b.55.1.2 (B:) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]}
mgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrryg
rdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaq

SCOPe Domain Coordinates for d1p5tb_:

Click to download the PDB-style file with coordinates for d1p5tb_.
(The format of our PDB-style files is described here.)

Timeline for d1p5tb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p5ta_