Lineage for d1p5ta_ (1p5t A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799111Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1799130Protein Docking protein 1, Dok1 [101834] (1 species)
  7. 1799131Species Mouse (Mus musculus) [TaxId:10090] [101835] (2 PDB entries)
    Uniprot P97465 152-254
  8. 1799132Domain d1p5ta_: 1p5t A: [94148]

Details for d1p5ta_

PDB Entry: 1p5t (more details), 2.35 Å

PDB Description: Crystal Structure of Dok1 PTB Domain
PDB Compounds: (A:) Docking protein 1

SCOPe Domain Sequences for d1p5ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5ta_ b.55.1.2 (A:) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]}
mgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrryg
rdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaqgk

SCOPe Domain Coordinates for d1p5ta_:

Click to download the PDB-style file with coordinates for d1p5ta_.
(The format of our PDB-style files is described here.)

Timeline for d1p5ta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p5tb_