Lineage for d1p5ta_ (1p5t A:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (8 families) 
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins) 
Protein Docking protein 1, Dok1 [101834] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [101835] (1 PDB entry) 
Domain d1p5ta_: 1p5t A: [94148]
Details for d1p5ta_
PDB Entry: 1p5t (more details), 2.35 Å
PDB Description: Crystal Structure of Dok1 PTB Domain
SCOP Domain Sequences for d1p5ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p5ta_ b.55.1.2 (A:) Docking protein 1, Dok1 {Mouse (Mus musculus)}
mgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrryg
rdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaqgk
SCOP Domain Coordinates for d1p5ta_:
Click to download the PDB-style file with coordinates for d1p5ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p5ta_:
- d1p5ta_ is new in SCOP 1.67
- d1p5ta_ appears in SCOP 1.69
- d1p5ta_ appears in the current release, SCOPe 2.08, called d1p5ta1
View in 3D
