Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
Protein DJ-1 [89603] (1 species) RNA-binding protein regulatory subunit |
Species Human (Homo sapiens) [TaxId:9606] [89604] (12 PDB entries) Uniprot Q99497 |
Domain d1p5fa_: 1p5f A: [94142] |
PDB Entry: 1p5f (more details), 1.1 Å
SCOP Domain Sequences for d1p5fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} skralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasledak kegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgsk vtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqvk aplvlk
Timeline for d1p5fa_: