Lineage for d1p5dx4 (1p5d X:368-463)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418216Fold d.129: TBP-like [55944] (7 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 418348Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 418349Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (3 proteins)
  6. 418370Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)
  7. 418371Species Pseudomonas aeruginosa [TaxId:287] [81374] (6 PDB entries)
  8. 418372Domain d1p5dx4: 1p5d X:368-463 [94141]
    Other proteins in same PDB: d1p5dx1, d1p5dx2, d1p5dx3
    complexed with g1p, zn

Details for d1p5dx4

PDB Entry: 1p5d (more details), 1.6 Å

PDB Description: enzyme-ligand complex of p. aeruginosa pmm/pgm

SCOP Domain Sequences for d1p5dx4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5dx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOP Domain Coordinates for d1p5dx4:

Click to download the PDB-style file with coordinates for d1p5dx4.
(The format of our PDB-style files is described here.)

Timeline for d1p5dx4: