Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.170: SRCR-like [56486] (2 superfamilies) unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta |
Superfamily d.170.1: SRCR-like [56487] (2 families) |
Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein) automatically mapped to Pfam PF09272 |
Protein Hepsin, N-terminal domain [103356] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103357] (4 PDB entries) Uniprot P05981 50-159 |
Domain d1p57a_: 1p57 A: [94125] Other proteins in same PDB: d1p57b_ complexed with cr4 |
PDB Entry: 1p57 (more details), 1.75 Å
SCOPe Domain Sequences for d1p57a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p57a_ d.170.1.2 (A:) Hepsin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp
Timeline for d1p57a_: