Lineage for d1p57a_ (1p57 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1941598Fold d.170: SRCR-like [56486] (2 superfamilies)
    unusual fold; disulfide-rich; core: beta-x-alpha-beta-loop-beta
  4. 1941599Superfamily d.170.1: SRCR-like [56487] (2 families) (S)
  5. 1941604Family d.170.1.2: Hepsin, N-terminal domain [103355] (1 protein)
    automatically mapped to Pfam PF09272
  6. 1941605Protein Hepsin, N-terminal domain [103356] (1 species)
  7. 1941606Species Human (Homo sapiens) [TaxId:9606] [103357] (4 PDB entries)
    Uniprot P05981 50-159
  8. 1941608Domain d1p57a_: 1p57 A: [94125]
    Other proteins in same PDB: d1p57b_
    complexed with cr4

Details for d1p57a_

PDB Entry: 1p57 (more details), 1.75 Å

PDB Description: extracellular domain of human hepsin
PDB Compounds: (A:) Serine protease hepsin

SCOPe Domain Sequences for d1p57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p57a_ d.170.1.2 (A:) Hepsin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
plypvqvssadarlmvfdktegtwrllcssrsnarvaglsceemgflralthseldvrta
gaagtsgffcvdegrlphtqrllevisvcdcprgrflaaicqdcgrrklp

SCOPe Domain Coordinates for d1p57a_:

Click to download the PDB-style file with coordinates for d1p57a_.
(The format of our PDB-style files is described here.)

Timeline for d1p57a_: