Lineage for d1p53b1 (1p53 B:283-366)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 786974Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 787032Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)
  7. 787033Species Human (Homo sapiens) [TaxId:9606] [49146] (7 PDB entries)
  8. 787044Domain d1p53b1: 1p53 B:283-366 [94121]
    Other proteins in same PDB: d1p53a2, d1p53a3, d1p53b2, d1p53b3
    D4; putative family assignment as the region corresponding to C and C' strands is disordered
    complexed with nag

Details for d1p53b1

PDB Entry: 1p53 (more details), 3.06 Å

PDB Description: the crystal structure of icam-1 d3-d5 fragment
PDB Compounds: (B:) intercellular adhesion molecule-1

SCOP Domain Sequences for d1p53b1:

Sequence, based on SEQRES records: (download)

>d1p53b1 b.1.1.3 (B:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceahprakvtlngvpaqplgpraqlllkatpedngrsf
scsatlevagqlihknqtrelrvl

Sequence, based on observed residues (ATOM records): (download)

>d1p53b1 b.1.1.3 (B:283-366) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpapnviltkpevsegtevtvkceagpraqlllkatpedngrsfscsatlevagqlihkn
qtrelrvl

SCOP Domain Coordinates for d1p53b1:

Click to download the PDB-style file with coordinates for d1p53b1.
(The format of our PDB-style files is described here.)

Timeline for d1p53b1: