SCOP 1.69: Domain d1p53a3: 1p53 A:367-450

Lineage for d1p53a3 (1p53 A:367-450)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (32 proteins)

6. Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49163] (5 PDB entries)

8. Domain d1p53a3: 1p53 A:367-450 [94120]
   Other proteins in same PDB: d1p53a1, d1p53b1

Details for d1p53a3

PDB Entry: 1p53, 3.06 Å

PDB Description: the crystal structure of icam-1 d3-d5 fragment

SCOP Domain Sequences for d1p53a3:

Sequence; same for both SEQRES and ATOM records:

>d1p53a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)}
ygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdleg
tylcrarstqgevtrevtvnvlsp

Timeline for d1p53a3:

• d1p53a3 first appeared in SCOP 1.67
  
• d1p53a3 appears in SCOP 1.71
  
• d1p53a3 appears in the current release, SCOPe 2.08