Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (32 proteins) |
Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49163] (5 PDB entries) |
Domain d1p53a3: 1p53 A:367-450 [94120] Other proteins in same PDB: d1p53a1, d1p53b1 |
PDB Entry: 1p53 (more details), 3.06 Å
SCOP Domain Sequences for d1p53a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p53a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)} ygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdleg tylcrarstqgevtrevtvnvlsp
Timeline for d1p53a3: