Lineage for d1p4sa_ (1p4s A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2473894Protein Adenylate kinase [52554] (16 species)
  7. 2473952Species Mycobacterium tuberculosis [TaxId:1773] [102343] (2 PDB entries)
    contains no zinc finger-like insertion
  8. 2473954Domain d1p4sa_: 1p4s A: [94117]

Details for d1p4sa_

PDB Entry: 1p4s (more details)

PDB Description: solution structure of mycobacterium tuberculosis adenylate kinase
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1p4sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4sa_ c.37.1.1 (A:) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mrvlllgppgagkgtqavklaeklgipqistgelfrrnieegtklgveakryldagdlvp
sdltnelvddrlnnpdaangfildgyprsveqakalhemlerrgtdidavlefrvseevl
lerlkgrgraddtddvilnrmkvyrdetaplleyyrdqlktvdavgtmdevfaralralg
k

SCOPe Domain Coordinates for d1p4sa_:

Click to download the PDB-style file with coordinates for d1p4sa_.
(The format of our PDB-style files is described here.)

Timeline for d1p4sa_: