Lineage for d1p4ra2 (1p4r A:201-592)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147804Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2147805Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2147972Family c.97.1.4: AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64198] (1 protein)
    duplication: consists of two domains of this fold with extra secondary structures within and in between the two core motifs
  6. 2147973Protein AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC [64199] (3 species)
  7. 2147995Species Human (Homo sapiens) [TaxId:9606] [102716] (3 PDB entries)
  8. 2148000Domain d1p4ra2: 1p4r A:201-592 [94114]
    Other proteins in same PDB: d1p4ra1, d1p4rb1
    complexed with 354, amz, k, xmp

Details for d1p4ra2

PDB Entry: 1p4r (more details), 2.55 Å

PDB Description: Crystal Structure of Human ATIC in complex with folate-based inhibitor BW1540U88UD
PDB Compounds: (A:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1p4ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4ra2 c.97.1.4 (A:201-592) AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC {Human (Homo sapiens) [TaxId: 9606]}
vsqmplrygmnphqtpaqlytlqpklpitvlngapgfinlcdalnawqlvkelkealgip
aaasfkhvspagaavgiplsedeakvcmvydlyktltpisaayarargadrmssfgdfva
lsdvcdvptakiisrevsdgiiapgyeeealtilskkkngnycvlqmdqsykpdenevrt
lfglhlsqkrnngvvdkslfsnvvtknkdlpesalrdlivatiavkytqsnsvcyakngq
vigigagqqsrihctrlagdkanywwlrhhpqvlsmkfktgvkraeisnaidqyvtgtig
ededlikwkalfeevpellteaekkewvekltevsissdaffpfrdnvdrakrsgvayia
apsgsaadkvvieacdelgiilahtnlrlfhh

SCOPe Domain Coordinates for d1p4ra2:

Click to download the PDB-style file with coordinates for d1p4ra2.
(The format of our PDB-style files is described here.)

Timeline for d1p4ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p4ra1