Lineage for d1p4na1 (1p4n A:1-164)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968875Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 2968886Protein Peptidyltransferase FemX [103177] (1 species)
  7. 2968887Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)
  8. 2968890Domain d1p4na1: 1p4n A:1-164 [94110]
    complexed with gol, mg

Details for d1p4na1

PDB Entry: 1p4n (more details), 1.9 Å

PDB Description: Crystal Structure of Weissella viridescens FemX:UDP-MurNAc-pentapeptide complex
PDB Compounds: (A:) FemX

SCOPe Domain Sequences for d1p4na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4na1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
pvlnlndpqaveryeefmrqspygqvtqdlgwakvknnwepvdvyleddqgaiiaamsml
lgdtptdkkfayaskgpvmdvtdvdlldrlvdeavkaldgrayvlrfdpevaysdefntt
lqdhgyvtrnrnvadagmhatiqprlnmvldltkfpdakttldl

SCOPe Domain Coordinates for d1p4na1:

Click to download the PDB-style file with coordinates for d1p4na1.
(The format of our PDB-style files is described here.)

Timeline for d1p4na1: