| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
| Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries) Uniprot P01901 22-299 |
| Domain d1p4la2: 1p4l A:2-181 [94107] Other proteins in same PDB: d1p4la1, d1p4lb_, d1p4ld_ mutant |
PDB Entry: 1p4l (more details), 2.9 Å
SCOPe Domain Sequences for d1p4la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p4la2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
phslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywe
retqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgc
dyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatllr
Timeline for d1p4la2: