![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species) |
![]() | Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries) |
![]() | Domain d1p4la2: 1p4l A:2-181 [94107] Other proteins in same PDB: d1p4la1, d1p4lb_, d1p4ld_ |
PDB Entry: 1p4l (more details), 2.9 Å
SCOP Domain Sequences for d1p4la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p4la2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB} phslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeywe retqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydgc dyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatllr
Timeline for d1p4la2: