SCOPe 2.05: Domain d1p4la1: 1p4l A:182-274

Lineage for d1p4la1 (1p4l A:182-274)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
   Uniprot P01901 22-299

8. Domain d1p4la1: 1p4l A:182-274 [94106]
   Other proteins in same PDB: d1p4la2, d1p4lb_, d1p4ld_
   mutant

Details for d1p4la1

PDB Entry: 1p4l, 2.9 Å

PDB Description: crystal structure of nk receptor ly49c mutant with its mhc class i ligand h-2kb

PDB Compounds: (A:) MHC class I h-2kb heavy chain

SCOPe Domain Sequences for d1p4la1:

Sequence; same for both SEQRES and ATOM records:

>d1p4la1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1p4la1:

• d1p4la1 first appeared in SCOP 1.67
  
• d1p4la1 appears in SCOPe 2.04
  
• d1p4la1 appears in SCOPe 2.06
  
• d1p4la1 appears in the current release, SCOPe 2.08