Lineage for d1p4la1 (1p4l A:182-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654838Domain d1p4la1: 1p4l A:182-274 [94106]
    Other proteins in same PDB: d1p4la2, d1p4lb_, d1p4ld_
    mutant

Details for d1p4la1

PDB Entry: 1p4l (more details), 2.9 Å

PDB Description: crystal structure of nk receptor ly49c mutant with its mhc class i ligand h-2kb
PDB Compounds: (A:) MHC class I h-2kb heavy chain

SCOP Domain Sequences for d1p4la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4la1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1p4la1:

Click to download the PDB-style file with coordinates for d1p4la1.
(The format of our PDB-style files is described here.)

Timeline for d1p4la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p4la2