SCOP 1.67: Domain d1p4il_: 1p4i L:

Lineage for d1p4il_ (1p4i L:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)

8. Domain d1p4il_: 1p4i L: [94105]
   Other proteins in same PDB: d1p4ih_
   part of anti-GCN4 peptide scFv
   mutant

Details for d1p4il_

PDB Entry: 1p4i, 2.8 Å

PDB Description: Crystal Structure of scFv against peptide GCN4

SCOP Domain Sequences for d1p4il_:

Sequence; same for both SEQRES and ATOM records:

>d1p4il_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
adavvtqesalttspgetvtltcrsstgavttsnyaswvqekpdhlftgliggtnnrapg
vparfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

Timeline for d1p4il_:

• d1p4il_ is new in SCOP 1.67
  
• d1p4il_ appears in SCOP 1.69
  
• d1p4il_ appears in the current release, SCOPe 2.08