Lineage for d1p4ih_ (1p4i H:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547125Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 547167Domain d1p4ih_: 1p4i H: [94104]
    Other proteins in same PDB: d1p4il_
    part of anti-GCN4 peptide scFv
    mutant

Details for d1p4ih_

PDB Entry: 1p4i (more details), 2.8 Å

PDB Description: Crystal Structure of scFv against peptide GCN4

SCOP Domain Sequences for d1p4ih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4ih_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5}
dvqlqesgpglvapsqslsitctvsgfsltdygvnwvrqspgkglewlgviwgdgitdyn
salksrlsvtkdnsksqvflkmnslqsgdsaryycvtglfdywgqgttltvs

SCOP Domain Coordinates for d1p4ih_:

Click to download the PDB-style file with coordinates for d1p4ih_.
(The format of our PDB-style files is described here.)

Timeline for d1p4ih_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p4il_