Lineage for d1p4ca_ (1p4c A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080284Protein Membrane-associated (S)-mandelate dehydrogenase [63898] (1 species)
  7. 2080285Species Pseudomonas putida [TaxId:303] [63899] (3 PDB entries)
  8. 2080286Domain d1p4ca_: 1p4c A: [94100]
    complexed with fmn, mes, so4; mutant

Details for d1p4ca_

PDB Entry: 1p4c (more details), 1.35 Å

PDB Description: high resolution structure of oxidized active mutant of (s)-mandelate dehydrogenase
PDB Compounds: (A:) l(+)-mandelate dehydrogenase

SCOPe Domain Sequences for d1p4ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]}
nlfnvedyrklaqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrrslq
aevlgkrqsmplligptglngalwpkgdlalaraatkagipfvlstasnmsiedlarqcd
gdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkippfltlkn
fegidlgkmdkanlemqaalmsrqmdasfnwealrwlrdlwphkllvkgllsaedadrci
aegadgvilsnhggrqldcaispmevlaqsvaktgkpvlidsgfrrgsdivkalalgaea
vllgratlyglaargetgvdevltllkadidrtlaqigcpditslspdylqne

SCOPe Domain Coordinates for d1p4ca_:

Click to download the PDB-style file with coordinates for d1p4ca_.
(The format of our PDB-style files is described here.)

Timeline for d1p4ca_: