Lineage for d1p4ac2 (1p4a C:75-273)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499400Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species)
  7. 2499401Species Bacillus subtilis [TaxId:1423] [102540] (3 PDB entries)
  8. 2499408Domain d1p4ac2: 1p4a C:75-273 [94095]
    Other proteins in same PDB: d1p4aa1, d1p4ab1, d1p4ac1, d1p4ad1
    complexed with pcp

Details for d1p4ac2

PDB Entry: 1p4a (more details), 2.22 Å

PDB Description: Crystal Structure of the PurR complexed with cPRPP
PDB Compounds: (C:) pur operon repressor

SCOPe Domain Sequences for d1p4ac2:

Sequence, based on SEQRES records: (download)

>d1p4ac2 c.61.1.1 (C:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk
tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst
inmkeksieiqngnflrff

Sequence, based on observed residues (ATOM records): (download)

>d1p4ac2 c.61.1.1 (C:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdnegstvsinyvsgssnriqtmslakrsmktgs
nvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinm
keksieiqngnflrff

SCOPe Domain Coordinates for d1p4ac2:

Click to download the PDB-style file with coordinates for d1p4ac2.
(The format of our PDB-style files is described here.)

Timeline for d1p4ac2: