Lineage for d1p4ac2 (1p4a C:75-273)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588209Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 588210Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 588211Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (12 proteins)
  6. 588345Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species)
  7. 588346Species Bacillus subtilis [TaxId:1423] [102540] (2 PDB entries)
  8. 588353Domain d1p4ac2: 1p4a C:75-273 [94095]
    Other proteins in same PDB: d1p4aa1, d1p4ab1, d1p4ac1, d1p4ad1

Details for d1p4ac2

PDB Entry: 1p4a (more details), 2.22 Å

PDB Description: Crystal Structure of the PurR complexed with cPRPP

SCOP Domain Sequences for d1p4ac2:

Sequence, based on SEQRES records: (download)

>d1p4ac2 c.61.1.1 (C:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk
tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst
inmkeksieiqngnflrff

Sequence, based on observed residues (ATOM records): (download)

>d1p4ac2 c.61.1.1 (C:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdnegstvsinyvsgssnriqtmslakrsmktgs
nvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinm
keksieiqngnflrff

SCOP Domain Coordinates for d1p4ac2:

Click to download the PDB-style file with coordinates for d1p4ac2.
(The format of our PDB-style files is described here.)

Timeline for d1p4ac2: