Lineage for d1p4ab1 (1p4a B:2-74)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533817Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein)
  6. 533818Protein N-terminal domain of Bacillus PurR [101022] (1 species)
  7. 533819Species Bacillus subtilis [TaxId:1423] [101023] (2 PDB entries)
  8. 533825Domain d1p4ab1: 1p4a B:2-74 [94092]
    Other proteins in same PDB: d1p4aa2, d1p4ab2, d1p4ac2, d1p4ad2

Details for d1p4ab1

PDB Entry: 1p4a (more details), 2.22 Å

PDB Description: Crystal Structure of the PurR complexed with cPRPP

SCOP Domain Sequences for d1p4ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4ab1 a.4.5.40 (B:2-74) N-terminal domain of Bacillus PurR {Bacillus subtilis}
kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
vpgaaggvkyipk

SCOP Domain Coordinates for d1p4ab1:

Click to download the PDB-style file with coordinates for d1p4ab1.
(The format of our PDB-style files is described here.)

Timeline for d1p4ab1: