Lineage for d1p49a_ (1p49 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138572Family c.76.1.2: Arylsulfatase [53653] (4 protein domains)
    includes additional C-terminal alpha+beta (sub)domain
  6. 2138588Protein Steryl-sulfatase [102649] (1 species)
    contains membrane-anchoring alpha-hairpin insertion
  7. 2138589Species Human (Homo sapiens) [TaxId:9606] [102650] (1 PDB entry)
    placental estrone/DHEA sulfatase
  8. 2138590Domain d1p49a_: 1p49 A: [94089]
    complexed with bog, ca, nag, po4

Details for d1p49a_

PDB Entry: 1p49 (more details), 2.6 Å

PDB Description: structure of human placental estrone/dhea sulfatase
PDB Compounds: (A:) steryl-sulfatase

SCOPe Domain Sequences for d1p49a_:

Sequence, based on SEQRES records: (download)

>d1p49a_ c.76.1.2 (A:) Steryl-sulfatase {Human (Homo sapiens) [TaxId: 9606]}
aasrpniilvmaddlgigdpgcygnktirtpnidrlasggvkltqhlaasplatpsraaf
mtgrypvrsgmaswsrtgvflftassgglptdeitfakllkdqgystaligkwhlgmsch
sktdfchhplhhgfnyfygisltnlrdckpgegsvfttgfkrlvflplqivgvtlltlaa
lnclgllhvplgvffsllflaaliltlflgflhyfrplncfmmrnyeiiqqpmsydnltq
rltveaaqfiqrntetpfllvlsylhvhtalfsskdfagksqhgvygdaveemdwsvgqi
lnlldelrlandtliyftsdqgahveevsskgeihggsngiykggkannweggirvpgil
rwprviqagqkideptsnmdifptvaklagaplpedriidgrdlmpllegksqrsdhefl
fhycnaylnavrwhpqnstsiwkaffftpnfnpvgsngcfathvcfcfgsyvthhdppll
fdiskdprernpltpaseprfyeilkvmqeaadrhtqtlpevpdqfswnnflwkpwlqlc
cpstglscqcdre

Sequence, based on observed residues (ATOM records): (download)

>d1p49a_ c.76.1.2 (A:) Steryl-sulfatase {Human (Homo sapiens) [TaxId: 9606]}
aasrpniilvmaddlgigdpgcygnktirtpnidrlasggvkltqhlaasplatpsraaf
mtgrypvrsgmaswsrtgvflftassgglptdeitfakllkdqgystaligkwhlgmsch
sktdfchhplhhgfnyfygisltnlrdckpgegsvfttgfkrlvflplqivgvtlltlaa
lnclgllhvplgvffsllflaaliltlflgflhyfrplncfmmrnyeiiqqpmsydnltq
rltveaaqfiqrntetpfllvlsylhvhtalfsskdfagksqhgvygdaveemdwsvgqi
lnlldelrlandtliyftsdqgahveevsskgeihggsngiykggkannweggirvpgil
rwprviqagqkideptsnmdifptvaklagaplpedriidgrdlmpllegksqrsdhefl
fhycnaylnavrwhpqnstsiwkaffftpnfnpvcfathvcfcfgsyvthhdppllfdis
kdprernpltpaseprfyeilkvmqeaadrhtqtlpevpdqfswnnflwkpwlqlccpst
glscqcdre

SCOPe Domain Coordinates for d1p49a_:

Click to download the PDB-style file with coordinates for d1p49a_.
(The format of our PDB-style files is described here.)

Timeline for d1p49a_: