Lineage for d1p48a2 (1p48 A:1-141)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503550Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 503551Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 503552Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 503597Protein Enolase [54828] (6 species)
  7. 503598Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries)
  8. 503608Domain d1p48a2: 1p48 A:1-141 [94086]
    Other proteins in same PDB: d1p48a1, d1p48b1

Details for d1p48a2

PDB Entry: 1p48 (more details), 2 Å

PDB Description: reverse protonation is the key to general acid-base catalysis in enolase

SCOP Domain Sequences for d1p48a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p48a2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d1p48a2:

Click to download the PDB-style file with coordinates for d1p48a2.
(The format of our PDB-style files is described here.)

Timeline for d1p48a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p48a1