Lineage for d1p44c_ (1p44 C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477209Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (45 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 477416Protein Enoyl-ACP reductase [51791] (5 species)
  7. 477474Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (6 PDB entries)
  8. 477479Domain d1p44c_: 1p44 C: [94078]

Details for d1p44c_

PDB Entry: 1p44 (more details), 2.7 Å

PDB Description: Targeting tuberculosis and malaria through inhibition of enoyl reductase: compound activity and structural data

SCOP Domain Sequences for d1p44c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p44c_ c.2.1.2 (C:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOP Domain Coordinates for d1p44c_:

Click to download the PDB-style file with coordinates for d1p44c_.
(The format of our PDB-style files is described here.)

Timeline for d1p44c_: