SCOP 1.71: Domain d1p43b2: 1p43 B:501-641

Lineage for d1p43b2 (1p43 B:501-641)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Enolase [54828] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries)

8. Domain d1p43b2: 1p43 B:501-641 [94075]
   Other proteins in same PDB: d1p43a1, d1p43b1
   complexed with mg, pag; mutant

Details for d1p43b2

PDB Entry: 1p43, 1.8 Å

PDB Description: reverse protonation is the key to general acid-base catalysis in enolase

SCOP Domain Sequences for d1p43b2:

Sequence; same for both SEQRES and ATOM records:

>d1p43b2 d.54.1.1 (B:501-641) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

Timeline for d1p43b2:

• d1p43b2 first appeared in SCOP 1.67
  
• d1p43b2 appears in SCOP 1.69
  
• d1p43b2 appears in SCOP 1.73
  
• d1p43b2 appears in the current release, SCOPe 2.08