Lineage for d1p43a2 (1p43 A:1-141)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602896Protein Enolase [54828] (6 species)
  7. 602897Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54829] (14 PDB entries)
  8. 602900Domain d1p43a2: 1p43 A:1-141 [94073]
    Other proteins in same PDB: d1p43a1, d1p43b1

Details for d1p43a2

PDB Entry: 1p43 (more details), 1.8 Å

PDB Description: reverse protonation is the key to general acid-base catalysis in enolase

SCOP Domain Sequences for d1p43a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p43a2 d.54.1.1 (A:1-141) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
avskvyarsvydsrgnptvevelttekgvfrsivpsgastgvhealemrdgdkskwmgkg
vlhavknvndviapafvkanidvkdqkavddflisldgtanksklganailgvslaasra
aaaeknvplykhladlskskt

SCOP Domain Coordinates for d1p43a2:

Click to download the PDB-style file with coordinates for d1p43a2.
(The format of our PDB-style files is described here.)

Timeline for d1p43a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p43a1