Lineage for d1p3y1_ (1p3y 1:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108181Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108182Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2108183Family c.34.1.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52508] (4 protein domains)
    Pfam PF02441; formerly DFP, DNA/pantothenate metabolism flavoprotein family
  6. 2108212Protein MrsD [102301] (1 species)
    binds FAD
  7. 2108213Species Bacillus sp. hil-y85/54728 [TaxId:69002] [102302] (1 PDB entry)
  8. 2108214Domain d1p3y1_: 1p3y 1: [94071]
    complexed with fad

Details for d1p3y1_

PDB Entry: 1p3y (more details), 2.54 Å

PDB Description: MrsD from Bacillus sp. HIL-Y85/54728
PDB Compounds: (1:) MrsD protein

SCOPe Domain Sequences for d1p3y1_:

Sequence, based on SEQRES records: (download)

>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]}
isilkdkklligicgsissvgissyllyfksffkeirvvmtktaedlipahtvsyfcdhv
ysehgengkrhshveigrwadiyciipatanilgqtangvamnlvattvlahphntiffp
nmndlmwnktvvsrnieqlrkdghiviepveimafeiatgtrkpnrglitpdkallaiek
gfk

Sequence, based on observed residues (ATOM records): (download)

>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]}
isilkdkklligicgsissvgissyllyfksffkeirvvmtktaedlipahtvsyfcdhv
ysehgengkrhshveigrwadiyciipatanilgqtangvamnlvattvlahphntiffp
nmndlmwnktvvsrnieqlrkdghiviepveimrglitpdkallaiekgfk

SCOPe Domain Coordinates for d1p3y1_:

Click to download the PDB-style file with coordinates for d1p3y1_.
(The format of our PDB-style files is described here.)

Timeline for d1p3y1_: