Lineage for d1p3ua_ (1p3u A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925023Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 925024Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 925142Family a.132.1.2: Heme oxygenase HemO (PigA) [63627] (1 protein)
  6. 925143Protein Heme oxygenase HemO (PigA) [63628] (2 species)
    gram-negative bacterial heme oxygenase/iron-starvation protein
  7. 925144Species Neisseria meningitidis [TaxId:487] [63629] (4 PDB entries)
  8. 925146Domain d1p3ua_: 1p3u A: [94069]
    complexed with hem, no

Details for d1p3ua_

PDB Entry: 1p3u (more details), 1.75 Å

PDB Description: Crystal Structures of the NO-and CO-Bound Heme Oxygenase From Neisseria Meningitidis: Implications for Oxygen Activation
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1p3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ua_ a.132.1.2 (A:) Heme oxygenase HemO (PigA) {Neisseria meningitidis [TaxId: 487]}
altfakrlkadttavhdsvdnlvmsvqpfvskenyikflklqsvfhkavdhiykdaelnk
aipeleymarydavtqdlkdlgeepykfdkelpyeagnkaigwlycaegsnlgaaflfkh
aqkldyngehgarhlaphpdgrgkhwrafvehlnalnltpeaeaeaiqgareafafykvv
lretfglaadaeapegmmp

SCOPe Domain Coordinates for d1p3ua_:

Click to download the PDB-style file with coordinates for d1p3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ua_: