Lineage for d1p3ua_ (1p3u A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361144Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 361145Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 361190Family a.132.1.2: Gram-negative bacterial heme oxygenase [63627] (1 protein)
  6. 361191Protein Gram-negative bacterial heme oxygenase [63628] (1 species)
  7. 361192Species Neisseria meningitidis [TaxId:487] [63629] (4 PDB entries)
  8. 361194Domain d1p3ua_: 1p3u A: [94069]
    complexed with hem, no

Details for d1p3ua_

PDB Entry: 1p3u (more details), 1.75 Å

PDB Description: Crystal Structures of the NO-and CO-Bound Heme Oxygenase From Neisseria Meningitidis: Implications for Oxygen Activation

SCOP Domain Sequences for d1p3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ua_ a.132.1.2 (A:) Gram-negative bacterial heme oxygenase {Neisseria meningitidis}
altfakrlkadttavhdsvdnlvmsvqpfvskenyikflklqsvfhkavdhiykdaelnk
aipeleymarydavtqdlkdlgeepykfdkelpyeagnkaigwlycaegsnlgaaflfkh
aqkldyngehgarhlaphpdgrgkhwrafvehlnalnltpeaeaeaiqgareafafykvv
lretfglaadaeapegmmp

SCOP Domain Coordinates for d1p3ua_:

Click to download the PDB-style file with coordinates for d1p3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ua_: