Lineage for d1p3ta_ (1p3t A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777868Family a.132.1.2: Heme oxygenase HemO (PigA) [63627] (1 protein)
  6. 777869Protein Heme oxygenase HemO (PigA) [63628] (2 species)
    gram-negative bacterial heme oxygenase/iron-starvation protein
  7. 777870Species Neisseria meningitidis [TaxId:487] [63629] (4 PDB entries)
  8. 777873Domain d1p3ta_: 1p3t A: [94068]
    complexed with hem

Details for d1p3ta_

PDB Entry: 1p3t (more details), 2.1 Å

PDB Description: Crystal Structures of the NO-and CO-Bound Heme Oxygenase From Neisseria Meningitidis: Implications for Oxygen Activation
PDB Compounds: (A:) Heme oxygenase 1

SCOP Domain Sequences for d1p3ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ta_ a.132.1.2 (A:) Heme oxygenase HemO (PigA) {Neisseria meningitidis [TaxId: 487]}
altfakrlkadttavhdsvdnlvmsvqpfvskenyikflklqsvfhkavdhiykdaelnk
aipeleymarydavtqdlkdlgeepykfdkelpyeagnkaigwlycaegsnlgaaflfkh
aqkldyngehgarhlaphpdgrgkhwrafvehlnalnltpeaeaeaiqgareafafykvv
lretfglaadaeapegmmp

SCOP Domain Coordinates for d1p3ta_:

Click to download the PDB-style file with coordinates for d1p3ta_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ta_: