Lineage for d1p3rb_ (1p3r B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378247Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (8 proteins)
  6. 378254Protein Disabled homolog 2 (Dab2) [101830] (1 species)
  7. 378255Species Mouse (Mus musculus) [TaxId:10090] [101831] (2 PDB entries)
  8. 378257Domain d1p3rb_: 1p3r B: [94066]

Details for d1p3rb_

PDB Entry: 1p3r (more details), 2.1 Å

PDB Description: Crystal structure of the phosphotyrosin binding domain(PTB) of mouse Disabled 1(Dab1)

SCOP Domain Sequences for d1p3rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3rb_ b.55.1.2 (B:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus)}
ektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqr
iwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaiktg
qqaeplvvdlkdlfqviynvkkkeedkk

SCOP Domain Coordinates for d1p3rb_:

Click to download the PDB-style file with coordinates for d1p3rb_.
(The format of our PDB-style files is described here.)

Timeline for d1p3rb_: