Lineage for d1p3ra_ (1p3r A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071257Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2071268Protein Disabled homolog 2 (Dab2) [101830] (1 species)
  7. 2071269Species Mouse (Mus musculus) [TaxId:10090] [101831] (2 PDB entries)
  8. 2071270Domain d1p3ra_: 1p3r A: [94065]

Details for d1p3ra_

PDB Entry: 1p3r (more details), 2.1 Å

PDB Description: Crystal structure of the phosphotyrosin binding domain(PTB) of mouse Disabled 1(Dab1)
PDB Compounds: (A:) Disabled homolog 2

SCOPe Domain Sequences for d1p3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]}
mektdeyllarfkgdgvkykakligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkq
riwvnislsgikiidektgviehehpvnkisfiardvtdnrafgyvcggegqhqffaikt
gqqaeplvvdlkdlfqviynvkkkeedk

SCOPe Domain Coordinates for d1p3ra_:

Click to download the PDB-style file with coordinates for d1p3ra_.
(The format of our PDB-style files is described here.)

Timeline for d1p3ra_: