| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (5 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries) |
| Domain d1p3mf_: 1p3m F: [94045] Other proteins in same PDB: d1p3ma_, d1p3mc_, d1p3md_, d1p3me_, d1p3mg_, d1p3mh_ protein/DNA complex; mutant |
PDB Entry: 1p3m (more details), 2.9 Å
SCOPe Domain Sequences for d1p3mf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3mf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
vtamdvvyalkrqgrtlygfgg
Timeline for d1p3mf_: