Lineage for d1p3mf_ (1p3m F:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909520Protein Histone H4 [47125] (5 species)
  7. 909521Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)
  8. 909558Domain d1p3mf_: 1p3m F: [94045]
    Other proteins in same PDB: d1p3ma_, d1p3mc_, d1p3md_, d1p3me_, d1p3mg_, d1p3mh_
    protein/DNA complex; mutant

Details for d1p3mf_

PDB Entry: 1p3m (more details), 2.9 Å

PDB Description: Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d1p3mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p3mf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
vlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrkt
vtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d1p3mf_:

Click to download the PDB-style file with coordinates for d1p3mf_.
(The format of our PDB-style files is described here.)

Timeline for d1p3mf_: